General Information

  • ID:  hor005709
  • Uniprot ID:  Q27441
  • Protein name:  Neuropeptide Y
  • Gene name:  NPY
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Highly expressed in the abdominal ganglion, to lesser extent in the pleural-pedal ganglion and much lower in the cerebral ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DNSEMLAPPPRPEEFTSAQQLRQYLAALNEYYSIMGRPRF
  • Length:  40(22-61)
  • Propeptide:  MQRVILVVLLLSCMAVLSVRADNSEMLAPPPRPEEFTSAQQLRQYLAALNEYYSIMGRPRFGKRGDSFRKREFFRTNGERYPEDAAAWTEFQ
  • Signal peptide:  MQRVILVVLLLSCMAVLSVRA
  • Modification:  T40 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May play a role in the regulation of viscermotor functions during egg laying.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q27441-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005709_AF2.pdbhor005709_ESM.pdb

Physical Information

Mass: 538406 Formula: C208H317N57O63S2
Absent amino acids: CHKVW Common amino acids: P
pI: 4.71 Basic residues: 4
Polar residues: 10 Hydrophobic residues: 11
Hydrophobicity: -80.25 Boman Index: -9529
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 58.75
Instability Index: 6278.5 Extinction Coefficient cystines: 4470
Absorbance 280nm: 114.62

Literature

  • PubMed ID:  1524828
  • Title:  Identification and molecular cloning of a neuropeptide Y homolog that produces prolonged inhibition in Aplysia neurons.